Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Syntaxin-2(STX2)

Recombinant Human Syntaxin-2(STX2)

SKU:CSB-CF022898HU

Regular price $1,908.00 USD
Regular price Sale price $1,908.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P32856

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK

Protein Names:Recommended name: Syntaxin-2 Alternative name(s): Epimorphin

Gene Names:Name:STX2 Synonyms:EPIM, STX2A, STX2B, STX2C

Expression Region:1-288

Sequence Info:full length protein

View full details