![Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e_180x.jpg?v=1659192297 180w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e_360x.jpg?v=1659192297 360w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e_540x.jpg?v=1659192297 540w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e_720x.jpg?v=1659192297 720w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e_900x.jpg?v=1659192297 900w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e_1080x.jpg?v=1659192297 1080w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e_1296x.jpg?v=1659192297 1296w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e_1512x.jpg?v=1659192297 1512w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e_1728x.jpg?v=1659192297 1728w, //www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e_2048x.jpg?v=1659192297 2048w)
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Transport
Target / Protein: SDHA
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P31040
AA Sequence: SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV
Tag info: N-terminal GST-tagged
Expression Region: 44-293aa
Protein length: Partial
MW: 54.1 kDa
Alternative Name(s): Flavoprotein subunit of complex II ;Fp
Relevance: Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor.
Reference: Compound heterozygous mutations in the flavoprotein gene of the respiratory chain complex II in a patient with Leigh syndrome.Parfait B., Chretien D., Roetig A., Marsac C., Munnich A., Rustin P.Hum. Genet. 106:236-243(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial
- Regular price
- $609.00 USD
- Sale price
- $609.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial protein(SDHA),partial
- Regular price
- $609.00 USD
- Sale price
- $609.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial
- Regular price
- $609.00 USD
- Sale price
- $609.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial
- Regular price
- $609.00 USD
- Sale price
- $609.00 USD
- Regular price
-
- Unit price
- per
Sold out