Gene Bio Systems
Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial
Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial
SKU:CSB-RP019854h
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Transport
Target / Protein: SDHA
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P31040
AA Sequence: SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV
Tag info: N-terminal GST-tagged
Expression Region: 44-293aa
Protein length: Partial
MW: 54.1 kDa
Alternative Name(s): Flavoprotein subunit of complex II ;Fp
Relevance: Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor.
Reference: Compound heterozygous mutations in the flavoprotein gene of the respiratory chain complex II in a patient with Leigh syndrome.Parfait B., Chretien D., Roetig A., Marsac C., Munnich A., Rustin P.Hum. Genet. 106:236-243(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
![Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial(SDHA),partial](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2dff8200-99b5-45e2-9089-a7eb0b3c440e.jpg?v=1659192297&width=1445)