Recombinant Human Stress-responsive DNAJB4-interacting membrane protein 1(SDIM1)

Recombinant Human Stress-responsive DNAJB4-interacting membrane protein 1(SDIM1)

CSB-CF744400HU
Regular price
$1,088.00 USD
Sale price
$1,088.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q6ZPB5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CGPSPGARTTLGSPLSLWSIKTPSHIFCTRRAINLGFPSPPLVQLIFWSLNAGLDLYLCL ISSCGFSQVFWPVEAFCSFSLSFFALALSHKFVICRLDQHIFSGFTKSLKNLPPCHRTDI

Protein Names:Recommended name: Stress-responsive DNAJB4-interacting membrane protein 1

Gene Names:Name:SDIM1

Expression Region:27-146

Sequence Info:full length protein