Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Sterol regulatory element-binding protein 1(SREBF1),partial

Recombinant Human Sterol regulatory element-binding protein 1(SREBF1),partial

SKU:CSB-CF022657HU

Regular price $869.00 USD
Regular price Sale price $869.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Cardiovascular

Uniprot ID: P36956

Gene Names: SREBF1

Organism: Homo sapiens (Human)

AA Sequence: MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL

Expression Region: 1-490aa

Sequence Info: Partial

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-tagged

MW: 54.5 kDa

Alternative Name(s): Class D basic helix-loop-helix protein 1 Short name: bHLHd1 Sterol regulatory element-binding transcription factor 1 Cleaved into the following chain: Processed sterol regulatory element-binding protein 1

Relevance: Transcriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the fatty acid and to a lesser degree the cholesterol synthesis pathway (By similarity). Binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC-3')

Reference: "Alternative splicing produces a constitutively active form of human SREBP-1."Harada N., Yonemoto H., Yoshida M., Yamamoto H., Yin Y., Miyamoto A., Hattori A., Wu Q., Nakagawa T., Nakano M., Teshigawara K., Mawatari K., Hosaka T., Takahashi A., Nakaya Y.Biochem. Biophys. Res. Commun. 368:820-826(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details