
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Signal Transduction
Uniprot ID: P52823
Gene Names: STC1
Organism: Homo sapiens (Human)
AA Sequence: SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Expression Region: 39-247aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 39.6 kDa
Alternative Name(s): STC
Relevance: Stimulates renal phosphate reabsorption, and could therefore prevent hypercalcemia.
Reference: "Signal peptide prediction based on analysis of experimentally verified cleavage sites." Zhang Z., Henzel W.J. Protein Sci. 13:2819-2824(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Stanniocalcin-1(STC1),partial
- Regular price
- $606.00 USD
- Sale price
- $606.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Stathmin-4(STMN4)
- Regular price
- $606.00 USD
- Sale price
- $606.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Statherin(STATH)
- Regular price
- $606.00 USD
- Sale price
- $606.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Protachykinin-1(TAC1)
- Regular price
- $606.00 USD
- Sale price
- $606.00 USD
- Regular price
-
- Unit price
- per
Sold out