Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Solute carrier organic anion transporter family member 2B1(SLCO2B1),partial

Recombinant Human Solute carrier organic anion transporter family member 2B1(SLCO2B1),partial

SKU:CSB-EP021746HU

Regular price $1,016.00 USD
Regular price Sale price $1,016.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:O94956

Gene Names:SLCO2B1

Organism:Homo sapiens (Human)

AA Sequence:FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF

Expression Region:461-564aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:18.4 kDa

Alternative Name(s):Organic anion transporter B (OATP-B) (Organic anion transporter polypeptide-related protein 2) (OATP-RP2) (OATPRP2) (Solute carrier family 21 member 9) (KIAA0880) (OATP2B1) (OATPB) (SLC21A9)

Relevance:Mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.

Reference:"Functional analysis of the extracellular cysteine residues in the human organic anion transporting polypeptide, OATP2B1." Hanggi E., Grundschober A.F., Leuthold S., Meier P.J., St-Pierre M.V. Mol. Pharmacol. 70:806-817(2006)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details