Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Solute carrier family 35 member F3 (SLC35F3), partial

Recombinant Human Solute carrier family 35 member F3 (SLC35F3), partial

SKU:Q8IY50

Regular price $819.00 USD
Regular price Sale price $819.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q8IY50

Gene Names: SLC35F3

Alternative Name(s): (Solute carrier family 35 member F3)

Abbreviation: Recombinant Human SLC35F3 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1-66aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKI

MW: 14.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Plays a role in the extracellular assembly of CsgA into thin aggregative fimbriae (Tafi) fibers. Assembly may also require CsgE. Tafi are thought to be assembled via an extracellular nucleation-precipitation (ENP) pathway, and possibly also via an intracellular non-CsgC-dependent pathway.

Reference: "Cyclic-di-GMP-mediated signalling within the sigma network of Escherichia coli." Weber H., Pesavento C., Possling A., Tischendorf G., Hengge R. Mol. Microbiol. 62: 1014-1034(2006)

Function:

View full details