Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial (Active)

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial (Active)

SKU:O95436

Regular price $654.00 USD
Regular price Sale price $654.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Signal Transduction

Uniprot ID: O95436

Gene Names: SLC34A2

Alternative Name(s): Sodium-phosphate transport protein 2B;Na+;NaPi3b;Sodium/phosphate cotransporter 2B;Na+;NaPi-2b;Solute carrier family 34 member 2

Abbreviation: Recombinant Human SLC34A2 protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 234-362aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal mFc-tagged

Target Protein Sequence: VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL

MW: 45.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 μg/mL can bind Anti-SLC34A2 recombinant antibody (CSB-RA021581MA2HU). The EC50 is 32.86-37.66 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Involved in actively transporting phosphate into cells via Na+ cotransport.

Reference: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Wilson R.K. Nature 434: 724-731 (2005)

Function:

View full details