Recombinant Human Small muscular protein(SMPX)

Recombinant Human Small muscular protein(SMPX)

CSB-EP887043HU
Regular price
$686.00 USD
Sale price
$686.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q9UHP9

Gene Names: SMPX

Organism: Homo sapiens (Human)

AA Sequence: MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Expression Region: 1-88aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 36.6 kDa

Alternative Name(s): Stretch-responsive skeletal muscle protein

Relevance: Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Reference: "Identification of a novel stretch-responsive skeletal muscle gene (Smpx)." Kemp T.J., Sadusky T.J., Simon M., Brown R., Eastwood M., Sassoon D.A., Coulton G.R. Genomics 72:260-271(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.