Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human SLP adapter and CSK-interacting membrane protein(SCIMP)

Recombinant Human SLP adapter and CSK-interacting membrane protein(SCIMP)

SKU:CSB-CF754405HU

Regular price $1,735.00 USD
Regular price Sale price $1,735.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q6UWF3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKH KQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVS IPSYIEPEDDYDDVEIPANTEKASF

Protein Names:Recommended name: SLP adapter and CSK-interacting membrane protein Alternative name(s): SLP65/SLP76, Csk-interacting membrane protein

Gene Names:Name:SCIMP Synonyms:C17orf87 ORF Names:UNQ5783/PRO16090

Expression Region:1-145

Sequence Info:full length protein

View full details