Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Serine-arginine-rich splicing factor 9(SRSF9)

Recombinant Human Serine-arginine-rich splicing factor 9(SRSF9)

SKU:CSB-RP002144h

Regular price $846.00 USD
Regular price Sale price $846.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transcription

Uniprot ID: Q13242

Gene Names: SRSF9

Organism: Homo sapiens (Human)

AA Sequence: MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY

Expression Region: 1-221aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 52.5 kDa

Alternative Name(s): Pre-mRNA-splicing factor SRp30CSplicing factor, arginine/serine-rich 9

Relevance: Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10

Reference: Identification and characterization of three members of the human SR family of pre-mRNA splicing factors.Screaton G.R., Caceres J.F., Mayeda A., Bell M.V., Plebanski M., Jackson D.G., Bell J.I., Krainer A.R.EMBO J. 14:4336-4349(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details