Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Serine-arginine-rich splicing factor 10(SRSF10)

Recombinant Human Serine-arginine-rich splicing factor 10(SRSF10)

SKU:CSB-EP525638HU

Regular price $846.00 USD
Regular price Sale price $846.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: O75494

Gene Names: SRSF10

Organism: Homo sapiens (Human)

AA Sequence: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI

Expression Region: 1-183aa

Sequence Info: Full Length of Isoform 3

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 38.2 kDa

Alternative Name(s): 40KDA SR-repressor protein ;SRrp40FUS-interacting serine-arginine-rich protein 1Splicing factor SRp38Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats ;TASR ;TLS-associated protein with SR repeatsTLS-associated serine-arginine protein ;TLS-associated SR protein

Relevance: Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Ses to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator.

Reference: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details