Recombinant Human Semenogelin-1(SEMG1)

SKU: CSB-EP021001HU

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Cell Biology

Uniprot ID: P04279

Gene Names: SEMG1

Organism: Homo sapiens (Human)

AA Sequence: QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT

Expression Region: 24-402aa

Sequence Info: Full Length of Isoform 2

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 58.8 kDa

Alternative Name(s): Cancer/testis antigen 103 Semenogelin I Short name: SGI Cleaved into the following 3 chains: Alpha-inhibin-92 Alpha-inhibin-31 Seminal basic protein

Relevance: Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA.

Reference: "Analysis of recombinant human semenogelin as an inhibitor of human sperm motility."Mitra A., Richardson R.T., O'Rand M.G.Biol. Reprod. 82:489-496(2010).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.