Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human respiratory syncytial virus B Small hydrophobic protein(SH)

Recombinant Human respiratory syncytial virus B Small hydrophobic protein(SH)

SKU:CSB-CF302455HPX

Regular price $1,674.00 USD
Regular price Sale price $1,674.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human respiratory syncytial virus B (strain 18537)

Uniprot NO.:P69359

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGNTSITIEFTSKFWPYFTLIHMILTPISLLIIITIMIAILNKLSEHKTFCNKTLELGQM YQINT

Protein Names:Recommended name: Small hydrophobic protein Alternative name(s): Small protein 1A

Gene Names:Name:SH Synonyms:1A

Expression Region:1-65

Sequence Info:full length protein

View full details