Recombinant Human Receptor activity-modifying protein 3(RAMP3)

SKU: CSB-CF019306HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O60896

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL

Protein Names:Recommended name: Receptor activity-modifying protein 3 Alternative name(s): Calcitonin-receptor-like receptor activity-modifying protein 3 Short name= CRLR activity-modifying protein 3

Gene Names:Name:RAMP3

Expression Region:24-148

Sequence Info:full length protein