Gene Bio Systems
Recombinant Human Putative uncharacterized protein encoded by LINC00052(LINC00052)
Recombinant Human Putative uncharacterized protein encoded by LINC00052(LINC00052)
SKU:CSB-CF822267HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q96N35
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNCDALLHHSAIPEDFLHIFLLLQKISVSLPLSLSQSVCLFYSISLCVSLLLHISLCVSV YVSLSLSSFPCFSLTHTHTHSQLSKDTSVLTFTFCFKQHTHFTLNYTSHAHELSAPSVHP TCVFTFKAAPSPRPAT
Protein Names:Recommended name: Putative uncharacterized protein encoded by LINC00052 Alternative name(s): Putative transmembrane protein 83
Gene Names:Name:LINC00052 Synonyms:NCRNA00052, TMEM83
Expression Region:1-136
Sequence Info:full length protein
