Gene Bio Systems
Recombinant Human Putative uncharacterized protein C17orf110(C17orf110)
Recombinant Human Putative uncharacterized protein C17orf110(C17orf110)
SKU:CSB-CF320592HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P0DI80
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDQLVFKETIWNDAFWQNPWDQGGLAVIILFITAVLLLILFAIVFGLLTSTENTQCEAGE EE
Protein Names:Recommended name: Putative uncharacterized protein C17orf110
Gene Names:Name:C17orf110
Expression Region:1-62
Sequence Info:full length protein
