Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Putative selection and upkeep of intraepithelial T-cells protein 1 homolog(SKINT1)

Recombinant Human Putative selection and upkeep of intraepithelial T-cells protein 1 homolog(SKINT1)

SKU:CSB-CF427557HU

Regular price $1,825.00 USD
Regular price Sale price $1,825.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:A8MVG2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIRWFQSHYTRPVYLYKDGKDLYGETISKYVERTELLKEAIGEGKVTLRILNVSADDDG QYHCFFKDRNVYEESITEVKVTATSLEIQILIHPPNSKGLLVECNSEGWLPQPQMEWRES RGEIIPPASKSHSQDRNRLFTMKMSLLLRDSSHGNITCYLQNPVTGQEERTSIVLPDKLF PWNSIWILILVAILAVLLFFIMLPSVELQQREQRNWCD

Protein Names:Recommended name: Putative selection and upkeep of intraepithelial T-cells protein 1 homolog Short name= Skint-1

Gene Names:Name:SKINT1

Expression Region:1-218

Sequence Info:full length protein

View full details