Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Putative L-type amino acid transporter 1-like protein IMAA(SLC7A5P2)

Recombinant Human Putative L-type amino acid transporter 1-like protein IMAA(SLC7A5P2)

SKU:CSB-CF861932HU

Regular price $1,792.00 USD
Regular price Sale price $1,792.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9GIP4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGAGPKRRALAAPVAEEKEEAREKMMAAKRADGAAPAGEGEGVTLQGNITLLKGVAVIV VAIMSSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYM LDVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACHSVQ LIVHQPTQVI

Protein Names:Recommended name: Putative L-type amino acid transporter 1-like protein IMAA Alternative name(s): hLAT1 3-transmembrane protein IMAA Short name= hLAT1 3TM IMAA hLAT1 3-transmembrane protein MMAA Short name= hLAT1 3TM MMAA

Gene Names:Name:SLC7A5P2 Synonyms:IMAA, MMAA

Expression Region:1-190

Sequence Info:full length protein

View full details