Recombinant Human Putative FXYD domain-containing ion transport regulator 8(FXYD6P3)

SKU: CSB-CF009098HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P58550

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SAAKEKEIDPFHYNYQTLRIGGLVFDVVLFLVPSCHLLSHRCKCSFNQKPQDPGDKEAQVENFITANAKEPQKAKN

Protein Names:Recommended name: Putative FXYD domain-containing ion transport regulator 8

Gene Names:Name:FXYD6P3 Synonyms:FXYD8

Expression Region:19-94

Sequence Info:full length protein