Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Pulmonary surfactant-associated protein C(SFTPC)

Recombinant Human Pulmonary surfactant-associated protein C(SFTPC)

SKU:CSB-EP021174HU

Regular price $1,098.00 USD
Regular price Sale price $1,098.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: P11686

Gene Names: SFTPC

Organism: Homo sapiens (Human)

AA Sequence: FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL

Expression Region: 24-58aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 30.7 kDa

Alternative Name(s): Pulmonary surfactant-associated proteolipid SPL(Val) SP5

Relevance: Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Reference: "Low molecular weight human pulmonary surfactant protein (SP5): isolation, characterization, and cDNA and amino acid sequences."Warr R.G., Hawgood S., Buckley D.I., Crisp T.M., Schilling J., Benson B.J., Ballard P.L., Clements J.A., White R.T.Proc. Natl. Acad. Sci. U.S.A. 84:7915-7919(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details