Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protransforming growth factor alpha(TGFA)

Recombinant Human Protransforming growth factor alpha(TGFA)

SKU:CSB-CF023445HU

Regular price $1,777.00 USD
Regular price Sale price $1,777.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P01135

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV

Protein Names:Recommended name: Protransforming growth factor alphaCleaved into the following chain: 1. Transforming growth factor alpha Short name= 2. TGF-alphaAlternative name(s): EGF-like TGF Short name= ETGF TGF type 1

Gene Names:Name:TGFA

Expression Region:24-160

Sequence Info:full length protein

View full details