Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein YIPF5(YIPF5)

Recombinant Human Protein YIPF5(YIPF5)

SKU:CSB-CF842626HU

Regular price $1,912.00 USD
Regular price Sale price $1,912.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q969M3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQ PYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV AYPCALLYGVFALISVF

Protein Names:Recommended name: Protein YIPF5 Alternative name(s): Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5 Smooth muscle cell-associated protein 5 Short name= SMAP-5 YIP1 family member 5

Gene Names:Name:YIPF5 Synonyms:FINGER5, YIP1A ORF Names:PP12723, SB140, UNQ3123/PRO10275

Expression Region:1-257

Sequence Info:full length protein

View full details