Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein YIPF4(YIPF4)

Recombinant Human Protein YIPF4(YIPF4)

SKU:CSB-CF861129HU

Regular price $1,693.00 USD
Regular price Sale price $1,693.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BSR8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQPPGPPPAYAPTNGDFTFVSSADAEDLSGSIASPDVKLNLGGDFIKESTATTFLRQRGY GWLLEVEDD DPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNP

Protein Names:Recommended name: Protein YIPF4Alternative name(s): YIP1 family member 4

Gene Names:Name:YIPF4ORF Names:Nbla11189

Expression Region:1-113

Sequence Info:full length protein

View full details