Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O60224
Gene Names: SSX4
Organism: Homo sapiens (Human)
AA Sequence: MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
Expression Region: 1-188aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 48.9 kDa
Alternative Name(s): Cancer/testis antigen 5.4
Relevance: Could act as a modulator of transcription.
Reference: "CD4+ T cell responses to SSX-4 in melanoma patients." Ayyoub M., Merlo A., Hesdorffer C.S., Rimoldi D., Speiser D., Cerottini J.C., Chen Y.T., Old L.J., Stevanovic S., Valmori D. J. Immunol. 174:5092-5099(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.