Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein PAPPAS(PAPPA-AS1)

Recombinant Human Protein PAPPAS(PAPPA-AS1)

SKU:CSB-CF719029HU

Regular price $1,682.00 USD
Regular price Sale price $1,682.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q5QFB9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRYGFVRKKHRGLFLTTVAALPIWNPISEFVKWYKSHKLSQHCIRICGHLCQKHLDMFLS VIGQRWPIDVFSSVFDHQVSAIGSDIIWWFLKLFLVSFFFFF

Protein Names:Recommended name: Protein PAPPAS Alternative name(s): DIPLA1 antisense RNA 1 DIPLA1 antisense gene protein 1 DIPLA1-antisense expressed PAPPAS antisense RNA 1 PAPPAS antisense gene protein 1 PAPPAS-antisense expressed

Gene Names:Name:PAPPA-AS1 Synonyms:DIPAS, PAPPAS

Expression Region:1-102

Sequence Info:full length protein

View full details