Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein FAM176A(FAM176A)

Recombinant Human Protein FAM176A(FAM176A)

SKU:CSB-CF862042HU

Regular price $1,743.00 USD
Regular price Sale price $1,743.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9H8M9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLAALVIRISCH TDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLNKNVFTSAEELER AQRLEERERIIREIWMNGQPEVPGTRSLNRYY

Protein Names:Recommended name: Protein FAM176A Alternative name(s): Transmembrane protein 166

Gene Names:Name:FAM176A Synonyms:TMEM166 ORF Names:SP24

Expression Region:1-152

Sequence Info:full length protein

View full details