Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Proprotein convertase subtilisin/kexin type 6 (PCSK6), partial

Recombinant Human Proprotein convertase subtilisin/kexin type 6 (PCSK6), partial

SKU:P29122

Regular price $524.00 USD
Regular price Sale price $524.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Neuroscience

Uniprot ID: P29122

Gene Names: PCSK6

Alternative Name(s): (Paired basic amino acid cleaving enzyme 4)(Subtilisin-like proprotein convertase 4)(SPC4)(Subtilisin/kexin-like protease PACE4)

Abbreviation: Recombinant Human PCSK6 protein, partial

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 860-969aa

Protein Length: Partial

Tag Info: C-terminal hFc1-tagged

Target Protein Sequence: REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

MW: 43.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues.

Reference: "Extraembryonic proteases regulate Nodal signalling during gastrulation." Beck S., Le Good J.A., Guzman M., Ben Haim N., Roy K., Beermann F., Constam D.B. Nat Cell Biol 4: 981-985(2002)

Function:

View full details