Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Probable E3 ubiquitin-protein ligase RNF144A(RNF144A)

Recombinant Human Probable E3 ubiquitin-protein ligase RNF144A(RNF144A)

SKU:CSB-CF019840HU

Regular price $1,915.00 USD
Regular price Sale price $1,915.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P50876

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTTRYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLE TAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC QLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDA PIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSR ASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT

Protein Names:Recommended name: Probable E3 ubiquitin-protein ligase RNF144A EC= 6.3.2.- Alternative name(s): RING finger protein 144A UbcM4-interacting protein 4 Ubiquitin-conjugating enzyme 7-interacting protein 4

Gene Names:Name:RNF144A Synonyms:KIAA0161, RNF144, UBCE7IP4

Expression Region:1-292

Sequence Info:Full length protein

View full details