Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Potassium channel subfamily K member 2(KCNK2),partial

Recombinant Human Potassium channel subfamily K member 2(KCNK2),partial

SKU:CSB-YP012070HU

Regular price $935.00 USD
Regular price Sale price $935.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Neuroscience

Uniprot ID: O95069

Gene Names: KCNK2

Organism: Homo sapiens (Human)

AA Sequence: MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD

Expression Region: 1-143aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 17.7 kDa

Alternative Name(s): Outward rectifying potassium channel protein TREK-1 TREK-1 K(+) channel subunit Two pore domain potassium channel TREK-1 Two pore potassium channel TPKC1

Relevance: Ion channel that contributes to passive transmembrane potassium transport (PubMed:23169818). Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner (PubMed:11319556). In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2. In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1

Reference: "Cloning, localisation and functional expression of the human orthologue of the TREK-1 potassium channel."Meadows H.J., Benham C.D., Cairns W., Gloger I., Jennings C., Medhurst A.D., Murdock P., Chapman C.G.Pflugers Arch. 439:714-722(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details