Gene Bio Systems
Recombinant Human Phosphatidylinositol N-acetylglucosaminyltransferase subunit P(PIGP)
Recombinant Human Phosphatidylinositol N-acetylglucosaminyltransferase subunit P(PIGP)
SKU:CSB-CF017979HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P57054
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVPRSTSLTLIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFI PESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAK NQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
Protein Names:Recommended name: Phosphatidylinositol N-acetylglucosaminyltransferase subunit P EC= 2.4.1.198 Alternative name(s): Down syndrome critical region protein 5 Down syndrome critical region protein C Phosphatidylinositol-glycan biosynth
Gene Names:Name:PIGP Synonyms:DCRC, DSCR5, DSCRC ORF Names:NPD010
Expression Region:1-158
Sequence Info:Full length protein
