Skip to product information
1 of 1

GeneBio Systems

Recombinant Human papillomavirus type 18 Probable protein E5 (E5)

Recombinant Human papillomavirus type 18 Probable protein E5 (E5)

SKU:P06792

Regular price $1,069.00 USD
Regular price Sale price $1,069.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P06792

Gene Names: E5

Alternative Name(s):

Abbreviation: Recombinant Human papillomavirus type 18 E5 protein

Organism: Human papillomavirus type 18

Source: E.coli

Expression Region: 1-73aa

Protein Length: Full Length

Tag Info: N-terminal GST-tagged

Target Protein Sequence: MLSLIFLFCFCVCMYVCCHVPLLPSVCMCAYAWVLVFVYIVVITSPATAFTVYVFCFLLPMLLLHIHAILSLQ

MW: 35.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference: "Nucleotide sequence and comparative analysis of the human papillomavirus type 18 genome. Phylogeny of papillomaviruses and repeated structure of the E6 and E7 gene products." Cole S.T., Danos O. J. Mol. Biol. 193: 599-608(1987)

Function:

View full details