Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Ninjurin-2(NINJ2)

Recombinant Human Ninjurin-2(NINJ2)

SKU:CSB-CF885775HU

Regular price $1,770.00 USD
Regular price Sale price $1,770.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9NZG7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSS HYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWRLNQLNNAATILVFFTVVINV FITAFGAHKTGFLAARASRNPL

Protein Names:Recommended name: Ninjurin-2 Alternative name(s): Nerve injury-induced protein 2

Gene Names:Name:NINJ2

Expression Region:1-142

Sequence Info:full length protein

View full details