Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Neutrophil defensin 3(DEFA3),partial

Recombinant Human Neutrophil defensin 3(DEFA3),partial

SKU:CSB-EP006655HU

Regular price $1,259.00 USD
Regular price Sale price $1,259.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P59666

Gene Names:DEFA3

Organism:Homo sapiens (Human)

AA Sequence:DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

Expression Region:39-94aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-SUMO-tagged

MW:22.4 kDa

Alternative Name(s):Defensin, alpha 3 (HNP-3) (HP-3) (HP3) (HP 3-56) (Neutrophil defensin 2) (HNP-2) (HP-2) (HP2) (DEF3)

Relevance:Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.

Reference:"Differentiation stage-specific expression of a gene during granulopoiesis." Wiedemann L.M., Francis G.E., Lamb R.F., Burns J.H., Winnie J.N., McKenzie E.D., Birnie G.D. Leukemia 3:227-234(1989)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Alpha-defensin family

Tissue Specificity:

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:2762

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=654448

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:1668

STRING Database Link:https://string-db.org/network/9606.ENSP00000328359

OMIM Database Link:https://www.omim.org/entry/604522604522604522

Lead Time Guidance:13-23 business days

View full details