Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Neuropeptide Y receptor type 2 (NPY2R), partial

Recombinant Human Neuropeptide Y receptor type 2 (NPY2R), partial

SKU:P49146

Regular price $847.00 USD
Regular price Sale price $847.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cardiovascular

Uniprot ID: P49146

Gene Names: NPY2R

Alternative Name(s): (NPY2-R)(NPY-Y2 receptor)(Y2 receptor)

Abbreviation: Recombinant Human NPY2R protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 326-381aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-SUMO-tagged

Target Protein Sequence: GWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV

MW: 19.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May function in the secretion of milk-fat droplets. May act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.

Reference: "Site-specific glycosylation of bovine butyrophilin." Sato T., Takio K., Kobata A., Greenwalt D.E., Furukawa K. J. Biochem. 117: 147-157(1995)

Function:

View full details