
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Neuroscience
Uniprot ID: P32297
Gene Names: CHRNA3
Organism: Homo sapiens (Human)
AA Sequence: SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
Expression Region: 32-240aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 44.6 kDa
Alternative Name(s):
Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Reference: "Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor." Mihovilovic M., Roses A.D. Exp. Neurol. 111:175-180(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3),partial
- Regular price
- $600.00 USD
- Sale price
- $600.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Acetylcholine receptor subunit alpha(CHRNA1),partial
- Regular price
- $600.00 USD
- Sale price
- $600.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Acetylcholine receptor subunit gamma(CHRNG),partial
- Regular price
- $872.00 USD
- Sale price
- $872.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial
- Regular price
- $768.00 USD
- Sale price
- $768.00 USD
- Regular price
-
- Unit price
- per
Sold out