Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Neural retina-specific leucine zipper protein(NRL)

Recombinant Human Neural retina-specific leucine zipper protein(NRL)

SKU:CSB-EP016086HU

Regular price $479.00 USD
Regular price Sale price $479.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P54845

Gene Names:NRL

Organism:Homo sapiens (Human)

AA Sequence:MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL

Expression Region:1-237aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:33.4 kDa

Alternative Name(s):NRL (D14S46E)

Relevance:Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.

Reference:"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B

Involvement in disease:Retinitis pigmentosa 27 (RP27); Retinal degeneration autosomal recessive clumped pigment type (RDCP)

Subcellular Location:Cytoplasm, Nucleus

Protein Families:BZIP family

Tissue Specificity:Expressed in the brain and the retina (PubMed:11477108). Expressed strongly in rod and cone cells (at protein level) (PubMed:11477108).

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:8002

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=652297

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:4901

STRING Database Link:https://string-db.org/network/9606.ENSP00000380193

OMIM Database Link:https://www.omim.org/entry/162080162080162080

Lead Time Guidance:3-7 business days

View full details