Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9BT67
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESG FPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFML TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWL WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY
Protein Names:Recommended name: NEDD4 family-interacting protein 1 Alternative name(s): Breast cancer-associated protein SGA-1M NEDD4 WW domain-binding protein 5 Putative MAPK-activating protein PM13 Putative NF-kappa-B-activating protein 164 Pu
Gene Names:Name:NDFIP1 Synonyms:N4WBP5 ORF Names:PSEC0192, PSEC0223
Expression Region:1-221
Sequence Info:full length protein