![Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6(NDUFB6)](http://cdn.shopify.com/s/files/1/0558/8588/9636/products/no_image_default_image-jpeg_3a54e64c-4209-4b9c-b80a-2aafe686a2b4_{width}x.jpg?v=1659246377)
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O95139
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMV HGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMK EFPDQHH
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 Alternative name(s): Complex I-B17 Short name= CI-B17 NADH-ubiquinone oxidoreductase B17 subunit
Gene Names:Name:NDUFB6
Expression Region:2-128
Sequence Info:Full length protein