Gene Bio Systems
Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2(NDUFA2),partial
Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2(NDUFA2),partial
SKU:CSB-RP029854h
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Transport
Uniprot ID: O43678
Gene Names: NDUFA2
Organism: Homo sapiens (Human)
AA Sequence: AAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
Expression Region: 4-99aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 37.6 kDa
Alternative Name(s): Complex I-B8 ;CI-B8NADH-ubiquinone oxidoreductase B8 subunit
Relevance: Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Reference: Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits.Ton C., Hwang D.M., Dempsey A.A., Liew C.-C.Biochem. Biophys. Res. Commun. 241:589-594(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
![Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2(NDUFA2),partial](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_8625dcf0-761d-460a-a5c2-c151301be060.jpg?v=1659197114&width=1445)