Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12(NDUFA12)

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12(NDUFA12)

SKU:CSB-EP883413HU

Regular price $755.00 USD
Regular price Sale price $755.00 USD
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q9UI09

Gene Names: NDUFA12

Organism: Homo sapiens (Human)

AA Sequence: MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

Expression Region: 1-145aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 44.1 kDa

Alternative Name(s): 13KDA differentiation-associated protein Complex I-B17.2

Relevance: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Reference: "Characterization of the human complex I NDUFB7 and 17.2-KDA cDNAs and mutational analysis of 19 genes of the HP fraction in complex I-deficient-patients." Triepels R., Smeitink J., Loeffen J., Smeets R., Trijbels F., van den Heuvel L. Hum. Genet. 106:385-391(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)