Gene Bio Systems
Recombinant Human Myosin light chain 1-3, skeletal muscle isoform(MYL1)
Recombinant Human Myosin light chain 1-3, skeletal muscle isoform(MYL1)
SKU:CSB-EP015305HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P05976
Gene Names: MYL1
Organism: Homo sapiens (Human)
AA Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
Expression Region: 1-150aa
Sequence Info: Full Length of Isoform MLC3
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 43.7 kDa
Alternative Name(s): Myosin light chain alkali 1/2
Relevance: Regulatory light chain of myosin. Does not bind calcium.
Reference: "Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms." Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H. Gene 66:135-146(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
