Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Myosin light chain 1-3, skeletal muscle isoform(MYL1)

Recombinant Human Myosin light chain 1-3, skeletal muscle isoform(MYL1)

SKU:CSB-EP015305HU

Regular price $754.00 USD
Regular price Sale price $754.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P05976

Gene Names: MYL1

Organism: Homo sapiens (Human)

AA Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Expression Region: 1-150aa

Sequence Info: Full Length of Isoform MLC3

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 43.7 kDa

Alternative Name(s): Myosin light chain alkali 1/2

Relevance: Regulatory light chain of myosin. Does not bind calcium.

Reference: "Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms." Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H. Gene 66:135-146(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details