Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Myosin-7 (MYH7), partial

Recombinant Human Myosin-7 (MYH7), partial

SKU:P12883

Regular price $813.00 USD
Regular price Sale price $813.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Signal Transduction

Uniprot ID: P12883

Gene Names: MYH7

Alternative Name(s): (Myosin heavy chain 7)(Myosin heavy chain slow isoform)(MyHC-slow)(Myosin heavy chain, cardiac muscle beta isoform)(MyHC-beta)

Abbreviation: Recombinant Human MYH7 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1-109aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged

Target Protein Sequence: MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRY

MW: 18.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Myosins are actin-based motor molecules with ATPase activity essential for muscle contraction. Forms regular bipolar thick filaments that, together with actin thin filaments, constitute the fundamental contractile unit of skeletal and cardiac muscle.

Reference: "Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity." Winkelmann D.A., Forgacs E., Miller M.T., Stock A.M. Nat. Commun. 6: 7974-7974(2015)

Function:

View full details