Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Mitochondrial inner membrane organizing system protein 1(MINOS1)

Recombinant Human Mitochondrial inner membrane organizing system protein 1(MINOS1)

SKU:CSB-CF722583HU

Regular price $1,652.00 USD
Regular price Sale price $1,652.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q5TGZ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQH DFQAPYLLHGKYVKEQEQ

Protein Names:Recommended name: Mitochondrial inner membrane organizing system protein 1

Gene Names:Name:MINOS1 Synonyms:C1orf151

Expression Region:1-78

Sequence Info:full length protein

View full details