Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Methyltransferase-like protein 23(METTL23)

Recombinant Human Methyltransferase-like protein 23(METTL23)

SKU:CSB-CF771463HU

Regular price $1,791.00 USD
Regular price Sale price $1,791.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q86XA0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYVWPCAVVLAQYLWFHRRSLPGKAILEIGAGVSLPGILAAKCGAEVILSDSSELPHCLE VCRQSCQMNNLPHLQVVGLTWGHISWDLLALPPQDIILASDVFFEPEDFEDILATIYFLM HKNPKVQLWSTYQVRSADWSLEALLYKWDMKCVHIPLESFDADKEDIAESTLPGRHTVEM LVISFAKDSL

Protein Names:Recommended name: Methyltransferase-like protein 23 EC= 2.1.1.-

Gene Names:Name:METTL23 Synonyms:C17orf95

Expression Region:1-190

Sequence Info:full length protein

View full details