Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Lymphocyte function-associated antigen 3(CD58)

Recombinant Human Lymphocyte function-associated antigen 3(CD58)

SKU:CSB-CF004946HU

Regular price $1,885.00 USD
Regular price Sale price $1,885.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P19256

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN

Protein Names:Recommended name: Lymphocyte function-associated antigen 3 Short name= Ag3 Alternative name(s): Surface glycoprotein LFA-3 CD_antigen= CD58

Gene Names:Name:CD58 Synonyms:LFA3

Expression Region:29-250

Sequence Info:full length protein

View full details