Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily B member 3(LILRB3)

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily B member 3(LILRB3)

SKU:CSB-CF012941HU

Regular price $2,363.00 USD
Regular price Sale price $2,363.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O75022

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKTDFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQAVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHSLTLRRKATEPPPSQEGEPPAEPSIYATLAIH

Protein Names:Recommended name: Leukocyte immunoglobulin-like receptor subfamily B member 3 Short name= LIR-3 Short name= Leukocyte immunoglobulin-like receptor 3 Alternative name(s): CD85 antigen-like family member A Immunoglobulin-like transcript 5 Short name= ILT-5 Monocyte inhibitory receptor HL9 CD_antigen= CD85a

Gene Names:Name:LILRB3 Synonyms:ILT5, LIR3

Expression Region:24-631

Sequence Info:full length protein

View full details