Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Leucine-rich PPR motif-containing protein, mitochondrial (LRPPRC), partial

Recombinant Human Leucine-rich PPR motif-containing protein, mitochondrial (LRPPRC), partial

SKU:P42704

Regular price $1,064.00 USD
Regular price Sale price $1,064.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Epigenetics and Nuclear Signaling

Uniprot ID: P42704

Gene Names: LRPPRC

Alternative Name(s): 130 leucine-rich protein;LRP 130;GP130

Abbreviation: Recombinant Human LRPPRC protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1221-1394aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: LFRKVIEEQLEPAVEKISIMAERLANQFAIYKPVTDFFLQLVDAGKVDDARALLQRCGAIAEQTPILLLFLLRNSRKQGKASTVKSVLELIPELNEKEEAYNSLMKSYVSEKDVTSAKALYEHLTAKNTKLDDLFLKRYASLLKYAGEPVPFIEPPESFEFYAQQLRKLRENSS

MW: 26.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May play a role in RNA metabolism in both nuclei and mitochondria. In the nucleus binds to HNRPA1-associated poly(A) mRNAs and is part of nmRNP complexes at late stages of mRNA maturation which are possibly associated with nuclear mRNA export. Positively modulates nuclear export of mRNAs containing the EIF4E sensitivity element (4ESE) by binding simultaneously to both EIF4E and the 4ESE and acting as a platform for assembly for the RNA export complex. Also binds to exportin XPO1/CRM1 to engage the nuclear pore and traffic the bound mRNAs to the cytoplasm.

Reference:

Function:

View full details