Gene Bio Systems
Recombinant Human Leptin receptor overlapping transcript-like 1(LEPROTL1)
Recombinant Human Leptin receptor overlapping transcript-like 1(LEPROTL1)
SKU:CSB-CF012876HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O95214
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW
Protein Names:Recommended name: Leptin receptor overlapping transcript-like 1
Gene Names:Name:LEPROTL1 ORF Names:My047, UNQ577/PRO1139
Expression Region:1-131
Sequence Info:Full length protein
