Gene Bio Systems
Recombinant Human Late cornified envelope-like proline-rich protein 1(LELP1)
Recombinant Human Late cornified envelope-like proline-rich protein 1(LELP1)
SKU:CSB-EP719414HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q5T871
Gene Names: LELP1
Organism: Homo sapiens (Human)
AA Sequence: MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE
Expression Region: 1-98aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 37.7 kDa
Alternative Name(s): Novel small proline-rich protein
Relevance:
Reference: "Association of a chromosome 1q21 locus in close proximity to a late cornified envelope-like proline-rich 1 (LELP1) gene with total serum IgE levels." Sharma M., Mehla K., Batra J., Ghosh B. J. Hum. Genet. 52:378-383(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
